Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial

Product Specifications

Product Name Alternative

Drosophila Delta homolog 3 (Delta3)

Abbreviation

Recombinant Human DLL3 protein, partial

Gene Name

DLL3

UniProt

Q9NYJ7

Expression Region

383-492aa

Organism

Homo sapiens (Human)

Target Sequence

FAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPC1 Human Gene Knockout Kit (CRISPR)
KN208602RB 1 Kit

GPC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C1QL4 activation kit by CRISPRa
GA117389 1 Kit

Human C1QL4 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS500142 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Mouse Th activation kit by CRISPRa
GA204332 1 Kit

Mouse Th activation kit by CRISPRa

Sign In for Pricing
View Details
WDR68 (DCAF7) Rabbit Polyclonal Antibody
TA365152 100 µL

WDR68 (DCAF7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF647 conjugate, 0.1mg/mL
BNC472231-100 1x 100 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details