Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-Synuclein Human, Recombinant

Alpha-Synuclein (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Neuroscience

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

Alpha-Synuclein is readily soluble in PBS.

Molecular Weight

14460 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVAT VAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ EGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Succinimidyl (4-Iodoacetyl) -aminobenzoate
sc-219221 10 mg

N-Succinimidyl (4-Iodoacetyl) -aminobenzoate

Sign In for Pricing
View Details
MFluor™ UV460 Anti-human CD5 Antibody *L17F12*
100510Y1-AAT 500 Tests

MFluor™ UV460 Anti-human CD5 Antibody *L17F12*

Sign In for Pricing
View Details
SB-334867 free base
M15972-01 1 g

SB-334867 free base

Sign In for Pricing
View Details
SB-334867 free base
M15972-02 500 mg

SB-334867 free base

Sign In for Pricing
View Details
SB-334867 free base
M15972-03 2 mg

SB-334867 free base

Sign In for Pricing
View Details
SB-334867 free base
M15972-04 5 mg

SB-334867 free base

Sign In for Pricing
View Details