Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-Synuclein (A30P) Human, Recombinant

Alpha-Synuclein (A30P) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Neuroscience

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

Alpha-Synuclein is readily soluble in PBS.

Molecular Weight

14486Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAPGKTKEGVLYVGSKTKEGVVHGVAT VAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ EGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Claudin 14 (CLDN14) ELISA Kit
MBS9908338-01 48 Well

Monkey Claudin 14 (CLDN14) ELISA Kit

Sign In for Pricing
View Details
Monkey Claudin 14 (CLDN14) ELISA Kit
MBS9908338-02 96 Well

Monkey Claudin 14 (CLDN14) ELISA Kit

Sign In for Pricing
View Details
Monkey Claudin 14 (CLDN14) ELISA Kit
MBS9908338-03 5x 96 Well

Monkey Claudin 14 (CLDN14) ELISA Kit

Sign In for Pricing
View Details
Monkey Claudin 14 (CLDN14) ELISA Kit
MBS9908338-04 10x 96 Well

Monkey Claudin 14 (CLDN14) ELISA Kit

Sign In for Pricing
View Details
Cyp2d3 (NM_173093) Rat Tagged Lenti ORF Clone
RR206627L3 10 µg

Cyp2d3 (NM_173093) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GPR14 (UTS2R) Rabbit Polyclonal Antibody
TA322286 100 µL

GPR14 (UTS2R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details