Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-Synuclein (A53T) Human, Recombinant

Alpha-Synuclein (A53T) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Neuroscience

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

Alpha-Synuclein is readily soluble in PBS.

Molecular Weight

14490Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTT VAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ EGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cysteine Conjugate beta-Lyase/CCBL1 Recombinant Protein Antigen
NBP1-83316PEP 0.1 mL

Cysteine Conjugate beta-Lyase/CCBL1 Recombinant Protein Antigen

Sign In for Pricing
View Details
HSP27 (pS82) Antibody
abx010948 100 µg

HSP27 (pS82) Antibody

Sign In for Pricing
View Details
Recombinant Syntrophomonas wolfei subsp. wolfei Glycerol-3-phosphate acyltransferase (plsY)
MBS7026730-01 0.02 mg

Recombinant Syntrophomonas wolfei subsp. wolfei Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Recombinant Syntrophomonas wolfei subsp. wolfei Glycerol-3-phosphate acyltransferase (plsY)
MBS7026730-02 0.1 mg

Recombinant Syntrophomonas wolfei subsp. wolfei Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Recombinant Syntrophomonas wolfei subsp. wolfei Glycerol-3-phosphate acyltransferase (plsY)
MBS7026730-03 5x 0.1 mg

Recombinant Syntrophomonas wolfei subsp. wolfei Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
AnD Balance 6000x 1g EK6000i
BAL2560 1 Each

AnD Balance 6000x 1g EK6000i

Sign In for Pricing
View Details