Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-Synuclein (E46K) Human, Recombinant

Alpha-Synuclein (E46K) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Neuroscience

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

Alpha-Synuclein is readily soluble in PBS.

Molecular Weight

14459 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKKGVVHGVAT VAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ EGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM5 Rabbit pAb
E45R24421N-50 50 µL

TRIM5 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral human AQP2 sgRNA gene knockout kit - Lentiviral human AQP2 sgRNA gene knockout kit (plasmid)
GTR15391919 1 Vial

Lentiviral human AQP2 sgRNA gene knockout kit - Lentiviral human AQP2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
BMPR-II siRNA (m2)
sc-156147 10 µM

BMPR-II siRNA (m2)

Sign In for Pricing
View Details
HAUS1P3 Protein Vector (Human) (pPM-C-HA)
23021021 500 ng

HAUS1P3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
HOBT Anhydrous extrapure, 99%
38653-01 25 g

HOBT Anhydrous extrapure, 99%

Sign In for Pricing
View Details
HOBT Anhydrous extrapure, 99%
38653-02 100 g

HOBT Anhydrous extrapure, 99%

Sign In for Pricing
View Details