Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Transthyretin (G53E) Human, Recombinant

Transthyretin (G53E) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

The lyophilized protein is readily soluble in PBS pH 7.4.

Molecular Weight

13833 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSES EELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRY TIAALLSPYSYSTTAVVTNPKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-, 1mL 15nm
GP-3101-15 1 mL

Colloidal Gold Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-, 1mL 15nm

Sign In for Pricing
View Details
Cdc42bpb Mouse Gene Knockout Kit (CRISPR)
KN502975 1 Kit

Cdc42bpb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NONO (NM_001145409) Human Over-expression Lysate
LC428868 20 µg

NONO (NM_001145409) Human Over-expression Lysate

Sign In for Pricing
View Details
Niclosamide Piperazinesalt
TRC-N234040-25MG 25 mg

Niclosamide Piperazinesalt

Sign In for Pricing
View Details
Recombinant Human Podoplanin/PDPN Protein (His & Fc Tag)
PKSH031284 100 µg

Recombinant Human Podoplanin/PDPN Protein (His & Fc Tag)

Sign In for Pricing
View Details
CPA2 Antibody
KC-7656-01 50 μL

CPA2 Antibody

Sign In for Pricing
View Details