What is the catalog number for Transthyretin (V122I) Human, Recombinant?

The catalog number for Transthyretin (V122I) Human, Recombinant is orb1401962.

What sizes are available for Transthyretin (V122I) Human, Recombinant?

Transthyretin (V122I) Human, Recombinant is available in the following size(s): 1 mg.

Is Transthyretin (V122I) Human, Recombinant in stock?

Transthyretin (V122I) Human, Recombinant is currently made to order / not held in immediate stock. Contact us for lead time.

Transthyretin (V122I) Human, Recombinant

Transthyretin (V122I) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

The lyophilized protein is readily soluble in PBS pH 7.4.

Molecular Weight

13775 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSES GELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRY TIAALLSPYSYSTTAVITNPKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M02106 100 µL

Anti-DHPS Mouse Monoclonal Antibody [Clone ID: OTI2C9]

Sign In for Pricing

View Details

K5015608 1.0 µg DNA

Ndufv1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing

View Details

A63342-100 100 µL

RNASE9 Polyclonal Antibody

Sign In for Pricing

View Details

FAB17901N-100UG 100 µg

Human Cadherin-11 Alexa Fluor 700 MAb (Clone 667039)

Sign In for Pricing

View Details

A39691-100UG 100 µg

CLTB Antibody, HRP conjugated

Sign In for Pricing

View Details

HY-148368 1 Each

CYD-4-61

Sign In for Pricing

View Details