Transthyretin (F87M/L110M), Human, Recombinant
Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. F87M/L110M TTR is an engineered variant unable to form a stable tetramer
Product Specifications
Source
Protein expressed in Escherichia coli
Purity
95% by Chromatography and SDS-PAGE
Form
Lyophilized 1 mg/vial
Solubility
The lyophilized protein is readily soluble in PBS pH 7.4.
Molecular Weight
13.7 kDa
Storage Conditions
Room temperature, avoid light exposure.
Notes
For research use only.
Preservative
The lyophilized protein is readily soluble in PBS pH 7.4
AA Sequence
GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
