TWEAK/TNFSF12, Human (CHO)

TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis, belongs to tumor necrosis factor (TNF) superfamily. TWEAK protein binds to FN14 and TNRFSF12/APO3, is a weak inducer of apoptosis[1]. TWEAK does have pro-apoptotic activity for tumor cell, mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells (ECs) [2]. TWEAK also increases IL-6 and IL-8 secretion, and could potentiate the pro-inflammatory activities of TNF and IL-1[3]. Human TWEAK protein is a type II transmembrane protein (M1-H249) with a transmembrane domain (22-42 a.a.) . TWEAK/TNFSF12 Protein, Human (CHO) is the extracellular part (R99-H249) of TWEAK protein, produced by CHO cells with tag free.

Product Specifications

Product Name Alternative

TWEAK/TNFSF12 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tweak-protein-human-cho.html

Purity

97.00

Smiles

RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Molecular Formula

8742 (Gene_ID) O43508-1/Q4ACW9 (R99-H249) (Accession)

Molecular Weight

Approximately 20-22 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Maecker H, et al. TWEAK attenuates the transition from innate to adaptive immunity. Cell. 2005 Dec 2;123 (5) :931-44.|[2]TNFSF12 TNF superfamily member 12 [Homo sapiens (human) ]|[3]Wiley SR, et al. TWEAK, a member of the TNF superfamily, is a multifunctional cytokine that binds the TweakR/Fn14 receptor. Cytokine Growth Factor Rev. 2003 Jun-Aug;14 (3-4) :241-9.|[4]Lammens A, et al. Crystal structure of human TWEAK in complex with the Fab fragment of a neutralizing antibody reveals insights into receptor binding. PLoS One. 2013 May 8;8 (5) :e62697.|[5]Lynch CN, et al. TWEAK induces angiogenesis and proliferation of endothelial cells. J Biol Chem. 1999 Mar 26;274 (13) :8455-9.|[6]Lynch CN, et al. TWEAK induces angiogenesis and proliferation of endothelial cells. J Biol Chem. 1999 Mar 26;274 (13) :8455-9.