Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 1 (MT-CO1), partial

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide I (COI) (COXI) (MTCO1)

Abbreviation

Recombinant Human MT-CO1 protein, partial

Gene Name

MT-CO1

UniProt

P00395

Expression Region

474-513aa

Organism

Homo sapiens (Human)

Target Sequence

EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.3 kDa

References & Citations

"Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J." Moilanen J.S., Finnila S., Majamaa K. Mol. Biol. Evol. 20:2132-2142 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CBWD1 (NM_018491) Human Recombinant Protein
TP322790L 1 mg

CBWD1 (NM_018491) Human Recombinant Protein

Ask
View Details
GCKR Human qPCR Primer Pair (NM_001486)
HP205356 200 Reactions

GCKR Human qPCR Primer Pair (NM_001486)

Ask
View Details
Arecaidine-d5 Hydrobromide
sc-210835 1 mg

Arecaidine-d5 Hydrobromide

Ask
View Details
Magic™ Antibody Discovery - Human Her2 / ErbB2 (23-652) Membrane Protein, PaRoom Temperatureial, -mIgG2a Fc tag
MP0198F Each

Magic™ Antibody Discovery - Human Her2 / ErbB2 (23-652) Membrane Protein, PaRoom Temperatureial, -mIgG2a Fc tag

Ask
View Details
KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (Azide free) (HRP)
MBS6312482-01 0.2 mL

KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (Azide free) (HRP)

Ask
View Details
KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (Azide free) (HRP)
MBS6312482-02 5x 0.2 mL

KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (Azide free) (HRP)

Ask
View Details