Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCGRT, Human (GST)

The FCGRT protein is a cell surface receptor that conveys passive humoral immunity through the selective uptake of monomeric IgG in milk. It binds IgG at the intestinal epithelium and forms an FcRn-IgG complex that is transcytosed across the epithelium, releasing IgG into the blood or tissue. FCGRT Protein, Human (GST) is the recombinant human-derived FCGRT protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

FCGRT Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcgrt-protein-human-gst.html

Purity

90.0

Smiles

AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Molecular Formula

2217 (Gene_ID) P55899 (A24-S297) (Accession)

Molecular Weight

Approximately 57.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR6B2 knockdown cell line
ABC-KD10866 1 Vial

Human OR6B2 knockdown cell line

Sign In for Pricing
View Details
ZFP64 AAV Vector (Human) (CMV)
51063101 1 µg

ZFP64 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MLXPL rabbit pAb
UB-GEN-11255 100 µL

MLXPL rabbit pAb

Sign In for Pricing
View Details
Rat Glycoprotein A33 (GPA33) ELISA Kit
RDR-GPA33-Ra-01 96 Tests

Rat Glycoprotein A33 (GPA33) ELISA Kit

Sign In for Pricing
View Details
Rat Glycoprotein A33 (GPA33) ELISA Kit
RDR-GPA33-Ra-02 48 Tests

Rat Glycoprotein A33 (GPA33) ELISA Kit

Sign In for Pricing
View Details
Kinesis Solvent Filter uHMWPE 1/16; 10um
CHR3159 1 Each

Kinesis Solvent Filter uHMWPE 1/16; 10um

Sign In for Pricing
View Details