Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Retinol-binding protein 4 (Rbp4) (Active)

Product Specifications

Product Name Alternative

(Plasma retinol-binding protein) (PRBP) (RBP)

Abbreviation

Recombinant Mouse Rbp4 protein (Active)

Gene Name

Rbp4

UniProt

Q00724

Expression Region

19-201aa

Organism

Mus musculus (Mouse)

Target Sequence

ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

YES

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr (CSB-MP025270MO) at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM19 Antibody
orb176701 100 µg

ADAM19 Antibody

Sign In for Pricing
View Details
RBM45 antibody - middle region
MBS3205679-01 0.1 mL

RBM45 antibody - middle region

Sign In for Pricing
View Details
RBM45 antibody - middle region
MBS3205679-02 5x 0.1 mL

RBM45 antibody - middle region

Sign In for Pricing
View Details
ZNF346 Rabbit pAb
E47R12235 100 µL

ZNF346 Rabbit pAb

Sign In for Pricing
View Details
GPNMB Human Pre-designed siRNA Set A
HY-RS05648 1 Set

GPNMB Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
VTCN1, ID (VTCN1, B7H4, V-set domain-containing T-cell activation inhibitor 1, B7h.5, Immune costimulatory protein B7-H4, Protein B7S1, T-cell costimulatory molecule B7x) (AP)
MBS6362906-01 0.2 mL

VTCN1, ID (VTCN1, B7H4, V-set domain-containing T-cell activation inhibitor 1, B7h.5, Immune costimulatory protein B7-H4, Protein B7S1, T-cell costimulatory molecule B7x) (AP)

Sign In for Pricing
View Details