Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Retinol-binding protein 4 (Rbp4) (Active)

Product Specifications

Product Name Alternative

(Plasma retinol-binding protein) (PRBP) (RBP)

Abbreviation

Recombinant Mouse Rbp4 protein (Active)

Gene Name

Rbp4

UniProt

Q00724

Expression Region

19-201aa

Organism

Mus musculus (Mouse)

Target Sequence

ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

YES

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr (CSB-MP025270MO) at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SEMA4A sgRNA gene knockout kit - Lentiviral human SEMA4A sgRNA gene knockout kit (plasmid)
GTR15364898 1 Vial

Lentiviral human SEMA4A sgRNA gene knockout kit - Lentiviral human SEMA4A sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Trans, trans-2,4-Nonadienal-D4
sc-478129 1 mg

Trans, trans-2,4-Nonadienal-D4

Sign In for Pricing
View Details
OR11H3P Recombinant Protein (Human)
RP079521 100 µg

OR11H3P Recombinant Protein (Human)

Sign In for Pricing
View Details
TTC3L sgRNA CRISPR Lentivector (Human) (Target 3)
K2547004 1.0 µg DNA

TTC3L sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Horse Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit
MBS9366841-01 48 Well

Horse Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit

Sign In for Pricing
View Details
Horse Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit
MBS9366841-02 96 Well

Horse Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit

Sign In for Pricing
View Details