Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPM1 Adenovirus (Mouse)

Product Specifications

Gene Name

DPM1

Gene Aliases

MPDS, CDGIE

Accession Number

NM_010072

Reactivity

Mouse

Vector Name

pAdeno

Buffer

DMEM with 2.5% glycerol

Shipping Conditions

High titer adenoviruses are shipped with dry ice and low titer adenoviruses are shipped with ice packs. For long term storage, it is recommended to store the viruses at -80°C in small aliquots to avoid repeated freeze-thaw cycles.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC16A3 Pre-designed siRNA Set B
SI014882B 1 Each

Human SLC16A3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Adora1 3'UTR GFP Stable Cell Line
TU151455 1.0 mL

Adora1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CYTH3 Antibody - N-terminal region
MBS3224114-01 0.1 mL

CYTH3 Antibody - N-terminal region

Sign In for Pricing
View Details
CYTH3 Antibody - N-terminal region
MBS3224114-02 5x 0.1 mL

CYTH3 Antibody - N-terminal region

Sign In for Pricing
View Details
HSD17B1 Conjugated Antibody
orb1620415 100 µL

HSD17B1 Conjugated Antibody

Sign In for Pricing
View Details
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2
PH00355-01 1 mg

H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2

Sign In for Pricing
View Details