Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Myoglobin (MB)

Product Specifications

Abbreviation

Recombinant Dog Myoglobin protein

Gene Name

MB

UniProt

P63113

Expression Region

2-154aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

GLSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.3 kDa

References & Citations

"The covalent structure of dog myoglobin." Dumur V., Dautrevaux M., Han K. Biochim. Biophys. Acta 420:376-386 (1976)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone H3 (Mono Methyl Lys36) Monoclonal Antibody
AN302112L-01 50 µL

Recombinant Histone H3 (Mono Methyl Lys36) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (Mono Methyl Lys36) Monoclonal Antibody
AN302112L-02 100 µL

Recombinant Histone H3 (Mono Methyl Lys36) Monoclonal Antibody

Sign In for Pricing
View Details
SDHA (NM_004168) Human Over-expression Lysate
LC401340 20 µg

SDHA (NM_004168) Human Over-expression Lysate

Sign In for Pricing
View Details
Human/Mouse/Rat NF-L Recombinant Rabbit monoclonal Antibody
HA723332B 100 µL

Human/Mouse/Rat NF-L Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Thy1 (Thy1.2) Mouse Monoclonal Antibody [Clone ID: 5a-8]
CL039B 100 µg

Thy1 (Thy1.2) Mouse Monoclonal Antibody [Clone ID: 5a-8]

Sign In for Pricing
View Details
CARD10 Human Gene Knockout Kit (CRISPR)
KN217652 1 Kit

CARD10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details