Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig von Willebrand factor (VWF), partial

Product Specifications

Product Name Alternative

VWF

Abbreviation

Recombinant Pig VWF protein, partial

Gene Name

VWF

UniProt

Q28833

Expression Region

1167-1334aa

Organism

Sus scrofa (Pig)

Target Sequence

DVVFVLEGSDKVGEANFNRSTEFVEEVIRRMDVGRDSVHVTVLQYSYVVAVEHSFREAQSKGEVLQRVREIRFQGGNRTNTGLALQYLSEHSFSASQGDREEAPNLVYMVTGNPASDEIKRMPGDIQVVPIGVGPDVDMQELERLSWPNAPIFIQDFETLPREAPDLV

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex, glycoprotein Ibalpha/IX/V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BVES (NM_007073) Human Tagged ORF Clone Lentiviral Particle
RC223919L3V 200 µL

BVES (NM_007073) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CDO1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2408422 100 µL

CDO1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
CSDE1 Rabbit Monoclonal Antibody [Clone ID: 23GB3510]
TA424684 100 µL

CSDE1 Rabbit Monoclonal Antibody [Clone ID: 23GB3510]

Sign In for Pricing
View Details
ZBTB16, CT (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (AP) discontinued
Z0744-35A-AP 200 µL

ZBTB16, CT (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (AP) discontinued

Sign In for Pricing
View Details
Ethyl 1- (5-chloro-6-oxo-1,6-dihydro-4-pyridazinyl) -4-piperidinec arboxylate
sc-327012 500 mg

Ethyl 1- (5-chloro-6-oxo-1,6-dihydro-4-pyridazinyl) -4-piperidinec arboxylate

Sign In for Pricing
View Details
Finerenone Impurity 181
RM-F260181-01 10 mg

Finerenone Impurity 181

Sign In for Pricing
View Details