Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP-D, Human (HEK293)

Surfactant protein-D Protein, Human (HEK293) produced in HEK293 cells is a multimeric collectin that is involved in innate immune defense and expressed in pulmonary, as well as non-pulmonary, epithelia. Surfactant protein-D Protein exerts antimicrobial effects and dampens inflammation through direct microbial interactions and modulation of host cell responses via a series of cellular receptors.

Product Specifications

Product Name Alternative

SP-D Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/surfactant-protein-d-protein-human-hek293.html

Purity

95.0

Smiles

AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

Molecular Formula

6441 (Gene_ID) P35247 (A21-F375) (Accession)

Molecular Weight

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Sorensen GL. Surfactant Protein D in Respiratory and Non-Respiratory Diseases. Front Med (Lausanne) . 2018 Feb 8;5:18.|[2]Crouch EC. Surfactant protein-D and pulmonary host defense. Respir Res. 2000;1 (2) :93-108. Epub 2000 Aug 25.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)
MBS1172107-01 0.05 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)

Ask
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)
MBS1172107-02 0.05 mg (Yeast)

Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)

Ask
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)
MBS1172107-03 0.2 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)

Ask
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)
MBS1172107-04 0.5 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)

Ask
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)
MBS1172107-05 0.05 mg (Baculovirus)

Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)

Ask
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)
MBS1172107-06 0.2 mg (Yeast)

Recombinant Cryptococcus neoformans var. neoformans serotype D Small COPII coat GTPase SAR1 (SAR1)

Ask
View Details