Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Transthyretin (V30G) Human, Recombinant

Transthyretin (V30G) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

The lyophilized protein is readily soluble in PBS pH 7.4.

Molecular Weight

13720 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

GPTGTGESKCPLMVKVLDAVRGSPAINVAGHVFRKAADDTWEPFASGKTSES GELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRY TIAALLSPYSYSTTAVVTNPKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA Rat Monoclonal Antibody [Clone ID: I3/2.3]
AM08044RP-N 100 µg

CD45 / LCA Rat Monoclonal Antibody [Clone ID: I3/2.3]

Sign In for Pricing
View Details
Anti-AGO1 | Argonaute 1, DyLight® 488 conjugated (40 µg)
AS09 527-DL488 40 µg

Anti-AGO1 | Argonaute 1, DyLight® 488 conjugated (40 µg)

Sign In for Pricing
View Details
Uncoated Rat E-Cad (E-Cadherin) ELISA Kit
E-UNEL-R0018-01 5x 96 Tests

Uncoated Rat E-Cad (E-Cadherin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat E-Cad (E-Cadherin) ELISA Kit
E-UNEL-R0018-02 15x 96 Tests

Uncoated Rat E-Cad (E-Cadherin) ELISA Kit

Sign In for Pricing
View Details
VNN1 Human Gene Knockout Kit (CRISPR)
KN423462 1 Kit

VNN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mefenamic-d3 Acyl-Beta-D-glucuronide
TRC-M205062-1MG 1 mg

Mefenamic-d3 Acyl-Beta-D-glucuronide

Sign In for Pricing
View Details