Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Transthyretin (V30G) Human, Recombinant

Transthyretin (V30G) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

The lyophilized protein is readily soluble in PBS pH 7.4.

Molecular Weight

13720 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

GPTGTGESKCPLMVKVLDAVRGSPAINVAGHVFRKAADDTWEPFASGKTSES GELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRY TIAALLSPYSYSTTAVVTNPKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FoxP1 Rabbit Polyclonal Antibody
ER1901-25 100 µL

FoxP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EWSR1 (NM_005243) Human Recombinant Protein
TP303709M 100 µg

EWSR1 (NM_005243) Human Recombinant Protein

Sign In for Pricing
View Details
NRP2 Human Gene Knockout Kit (CRISPR)
KN210928LP 1 Kit

NRP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RUNDC3B (NM_138290) Human Recombinant Protein
TP321157L 1 mg

RUNDC3B (NM_138290) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF488A conjugate, 0.1mg/mL
BNC881841-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RIPPLY3 (NM_018962) Human Recombinant Protein
TP313078M 100 µg

RIPPLY3 (NM_018962) Human Recombinant Protein

Sign In for Pricing
View Details