Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-12, Mouse (HEK293, His)

MMP-12 protein has significant elastolytic activity and may contribute to tissue damage and remodeling.Its substrate preferences include preference for leucine at the P1' site and aromatic/hydrophobic residues at the P1 site, and preference for small hydrophobic residues such as alanine at the P3 site.MMP-12 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-12 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-12-protein-mouse-hek-293-his.html

Purity

98.00

Smiles

APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC

Molecular Formula

17381 (Gene_ID) P34960 (A29-C473) (Accession)

Molecular Weight

Approximately 64.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-500 1x 500 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details