Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-12, Mouse (HEK293, His)

MMP-12 protein has significant elastolytic activity and may contribute to tissue damage and remodeling.Its substrate preferences include preference for leucine at the P1' site and aromatic/hydrophobic residues at the P1 site, and preference for small hydrophobic residues such as alanine at the P3 site.MMP-12 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-12 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-12-protein-mouse-hek-293-his.html

Purity

98.00

Smiles

APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC

Molecular Formula

17381 (Gene_ID) P34960 (A29-C473) (Accession)

Molecular Weight

Approximately 64.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL17 (NM_198317) Human Tagged Lenti ORF Clone
RC212782L3 10 µg

KLHL17 (NM_198317) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Interferon gamma (IFNg) (APC) discontinued
I7662-17A1-APC 100 µL

Interferon gamma (IFNg) (APC) discontinued

Sign In for Pricing
View Details
Intersectin 2 (ITSN2) Human shRNA Plasmid Kit (Locus ID 50618)
TR303865 1 Kit

Intersectin 2 (ITSN2) Human shRNA Plasmid Kit (Locus ID 50618)

Sign In for Pricing
View Details
MEDIMAX 2.0 (IVD Class A) - desk device
79202 1 Each

MEDIMAX 2.0 (IVD Class A) - desk device

Sign In for Pricing
View Details
Rat N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit
MBS034539-01 48 Well

Rat N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit

Sign In for Pricing
View Details
Rat N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit
MBS034539-02 96 Well

Rat N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit

Sign In for Pricing
View Details