Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19, Cynomolgus/Rhesus Macaque (HEK293, His)

CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD19 Protein, Cynomolgus/Rhesus Macaque (HEK293, His), Rhesus Macaque; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd19-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

97.00

Smiles

QEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK

Molecular Formula

102145514/705211 (Gene_ID) XP_005591597.1/F7F486 (Q21-K292) (Accession)

Molecular Weight

Approximately 44-75 kDa due to the glycosylation.

References & Citations

[1]Jin X, et al. Therapeutic efficacy of anti-CD19 CAR-T cells in a mouse model of systemic lupus erythematosus. Cell Mol Immunol. 2021 Aug;18 (8) :1896-1903.|[2]Atkinson JR, et al. Protective Humoral Immunity in the Central Nervous System Requires Peripheral CD19-Dependent Germinal Center Formation following Coronavirus Encephalomyelitis. J Virol. 2017 Nov 14;91 (23) :e01352-17.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C5 (C5) Goat Polyclonal Antibody
AP21462SU-N 1 mL

Complement C5 (C5) Goat Polyclonal Antibody

Sign In for Pricing
View Details
MEF2 (MEF2A, MEF-2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1)
323516-01 50 µg

MEF2 (MEF2A, MEF-2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1)

Sign In for Pricing
View Details
MEF2 (MEF2A, MEF-2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1)
323516-02 100 µg

MEF2 (MEF2A, MEF-2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1)

Sign In for Pricing
View Details
Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit
SL2410Hu-01 48 Tests

Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit

Sign In for Pricing
View Details
Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit
SL2410Hu-02 96 Tests

Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit

Sign In for Pricing
View Details
HPA1 Polyclonal Antibody
RA26045-01 50 µL

HPA1 Polyclonal Antibody

Sign In for Pricing
View Details