Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Biliverdin Reductase A/BLVRA, Human (C-His)

Biliverdin Reductase A/BLVRA Protein, Human (C-His) expresses in E. coli with a His tag. Biliverdin reductase-A (BVR-A) is a serine/threonine/tyrosine kinase involved in the regulation of insulin signaling[1].

Product Specifications

Product Name Alternative

Biliverdin Reductase A/BLVRA Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/biliverdin-reductase-a-blvra-protein-human-c-his.html

Purity

95.01

Smiles

ERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSHHHHHH

Molecular Formula

644 (Gene_ID) P53004 (E6-S294) (Accession)

Molecular Weight

Approximately 40.0 kDa

References & Citations

[1]Cimini FA, et al. Reduced biliverdin reductase-A levels are associated with early alterations of insulin signaling in obesity. Biochim Biophys Acta Mol Basis Dis. 2019;1865 (6) :1490-1501.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPD2 (NM_177542) Human Tagged Lenti ORF Clone
RC201250L3 10 µg

SNRPD2 (NM_177542) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Natural Cytotoxicity Triggering Receptor 1
548905 200 µL

Natural Cytotoxicity Triggering Receptor 1

Sign In for Pricing
View Details
SERP1 Antibody
MBS5311821-01 0.1 mL

SERP1 Antibody

Sign In for Pricing
View Details
SERP1 Antibody
MBS5311821-02 5x 0.1 mL

SERP1 Antibody

Sign In for Pricing
View Details
TAT (47-57), TAMRA-labeled
HY-P4105 1 Each

TAT (47-57), TAMRA-labeled

Sign In for Pricing
View Details
Smad1 HDR Plasmid (h)
sc-400182-HDR 20 µg

Smad1 HDR Plasmid (h)

Sign In for Pricing
View Details