Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CC, Human (His)

PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

PPP1CC Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppp1cc-protein-human-his.html

Purity

92.00

Smiles

MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

Molecular Formula

5501 (Gene_ID) P36873-1 (M1-K323) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP155 (NM_153485) Human Over-expression Lysate
LY403513 100 µg

NUP155 (NM_153485) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha-2-Macroglobulin Antibody
KC-255-01 50 μL

Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
Alpha-2-Macroglobulin Antibody
KC-255-02 100 µL

Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
Alpha-2-Macroglobulin Antibody
KC-255-03 1 mL

Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
1,1-Dichlorocyclohexane
TRC-D734080-25MG 25 mg

1,1-Dichlorocyclohexane

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS638305 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details