Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CC, Human (His)

PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

PPP1CC Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppp1cc-protein-human-his.html

Purity

92.00

Smiles

MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

Molecular Formula

5501 (Gene_ID) P36873-1 (M1-K323) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]
TA804120BM 100 µL

L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]

Sign In for Pricing
View Details
TRAF5 (NM_004619) Human Recombinant Protein
TP319243M 100 µg

TRAF5 (NM_004619) Human Recombinant Protein

Sign In for Pricing
View Details
TCN1 (NM_001062) Human Over-expression Lysate
LC400432 20 µg

TCN1 (NM_001062) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Cebpb activation kit by CRISPRa
GA200691 1 Kit

Mouse Cebpb activation kit by CRISPRa

Sign In for Pricing
View Details
DLL4 Rabbit Polyclonal Antibody
ER1706-63 100 µL

DLL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
tert-Butyl 2-(Piperidin-4-yl)acetate
TRC-B814415-250MG 250 mg

tert-Butyl 2-(Piperidin-4-yl)acetate

Sign In for Pricing
View Details