KYAT1, Human (His)
The KYAT1 protein catalyzes the irreversible ammonia action of L-kynurenine to produce kynurenic acid (KA), which is an intermediate in the tryptophan catabolic pathway and a broad-spectrum antagonist of excitatory amino acid receptors. KYAT1 Protein, Human (His) is the recombinant human-derived KYAT1 protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
KYAT1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/kyat1-protein-human-his-sumo.html
Purity
95.00
Smiles
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
Molecular Formula
883 (Gene_ID) Q16773-2 (M1-L372) (Accession)
Molecular Weight
Approximately 42 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880994-100 1x 100 µL
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682559-100 1x 100 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880709-100 1x 100 µL
Human Kappa Light Chain (KLC709), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401119-100 1x 100 µL
TGFalpha (TGFA/1119), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740334-100 1x 100 µL
Cytokeratin 8 (H1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details