Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KYAT1, Human (His)

The KYAT1 protein catalyzes the irreversible ammonia action of L-kynurenine to produce kynurenic acid (KA), which is an intermediate in the tryptophan catabolic pathway and a broad-spectrum antagonist of excitatory amino acid receptors. KYAT1 Protein, Human (His) is the recombinant human-derived KYAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

KYAT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kyat1-protein-human-his-sumo.html

Purity

95.00

Smiles

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

Molecular Formula

883 (Gene_ID) Q16773-2 (M1-L372) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody [Alexa Fluor 700]
NB100-530AF700 0.1 mL

Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody [Alexa Fluor 700]

Ask
View Details
FABP3, NT (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (Biotin) discontinued
F0019-80B-Biotin 200 µL

FABP3, NT (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (Biotin) discontinued

Ask
View Details
Anti-Fibroblast Growth Factor Receptor 1 (FGFR1) Antibody
30102-1 250 µg

Anti-Fibroblast Growth Factor Receptor 1 (FGFR1) Antibody

Ask
View Details
METTL2B, NT (METTL2B, Methyltransferase-like protein 2B) (PE) discontinued
038388-PE 200 µL

METTL2B, NT (METTL2B, Methyltransferase-like protein 2B) (PE) discontinued

Ask
View Details
IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (MaxLight 550)
247634-ML550 100 µL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (MaxLight 550)

Ask
View Details
Olfr193 (NM_001011791) Mouse Tagged ORF Clone Lentiviral Particle
MR213430L3V 200 µL

Olfr193 (NM_001011791) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details