Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bombyx mori General odorant-binding protein 1

Product Specifications

Product Name Alternative

(GOBP1)

Abbreviation

Recombinant Bombyx mori General odorant-binding protein 1 protein

UniProt

P34171

Expression Region

19-164aa

Organism

Bombyx mori (Silk moth)

Target Sequence

DVYVMKDVTLGFGQALEQCREESQLTEEKMEEFFHFWNDDFKFEHRELGCAIQCMSRHFNLLTDSSRMHHENTDKFIKSFPNGEILSQKMIDMIHTCEKTFDSEPDHCWRILRVAECFKDACNKSGLAPSMELILAEFIMESEADK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Present in the aqueous fluid surrounding olfactory sensory dendrites and are thought to aid in the capture and transport of hydrophobic odorants into and through this fluid.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.6 kDa

References & Citations

"Binding proteins from the antennae of Bombyx mori." Krieger J., von Nickisch-Rosenegk E., Mameli M., Pelosi P., Breer H. Insect Biochem. Mol. Biol. 26:297-307 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-100 1x 100 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD99 (MIC2/877), CF640R conjugate, 0.1mg/mL
BNC400877-100 1x 100 µL

CD99 (MIC2/877), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF740 conjugate, 0.1mg/mL
BNC740507-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details