Recombinant Vaccinia virus Envelope phospholipase F13 (VACWR052)
Product Specifications
Product Name Alternative
(37 kDa protein) (Palmitoylated EV membrane protein) (p37K)
Abbreviation
Recombinant Vaccinia virus VACWR052 protein
Gene Name
VACWR052
UniProt
P04021
Expression Region
1-372aa
Organism
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )
Target Sequence
MWPFASVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKGIKIIVLLDERGKRNLGELQSHCPDINFITVNIDKKNNVGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKI
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Signal Transduction
Relevance
Major envelope protein that plays a role in the biogenesis of the viral double membrane and in egress of virus from the host cell. Produces the wrapped form of virus that is required for cell-to-cell spread. Acts as a lipase with broad specificity including phospholipase C, phospholipase A, and triacylglycerol lipase activities.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
49.2 kDa
References & Citations
"Topology of epitope-tagged F13L protein, a major membrane component of extracellular vaccinia virions." Husain M., Weisberg A., Moss B. Virology 308:233-242 (2003)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881081-100 1x 100 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details