IL-9, Human (HEK293, His)
IL-9 protein, secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, regulates immune response against parasites, intestinal permeability, and adaptive immunity. It induces differentiation of TH17 cells and mast cell proliferation through IL9R and IL2RG receptor stimulation, activating JAK1, JAK3, STAT1, STAT3, and STAT5. IL-9's diverse effects are mediated by its interaction with IL9R subunit and IL2RG. IL-9 Protein, Human (HEK293, His) is the recombinant human-derived IL-9 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
IL-9 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-9-protein-human-hek293-his.html
Purity
95.63
Smiles
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Molecular Formula
3578 (Gene_ID) P15248 (Q19-I144) (Accession)
Molecular Weight
Approximately 25-40kD, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF640R conjugate, 0.1mg/mL
TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF640R conjugate, 0.1mg/mL
