Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLIPR1, Human (HEK293, His)

GLIPR1 Protein is a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. It may function as a tumor inducer or a tumor suppressor. GLIPR1 promotes cell survival, growth, chemoresistance, and metastasis of glioma by multiple mechanisms, including the activation of STAT3 and CXCR4 signaling. GLIPR1 Protein, Human (HEK293, His) is the recombinant human-derived GLIPR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GLIPR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glipr1-protein-human-hek-293-his.html

Smiles

ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR

Molecular Formula

11010 (Gene_ID) P48060-1 (A22-R232) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Tiu YC, et al. GLIPR1 promotes proliferation, metastasis and 5-fluorouracil resistance in hepatocellular carcinoma by activating the PI3K/PDK1/ROCK1 pathway. Cancer Gene Ther. 2022 Nov;29 (11) :1720-1730.|[2]Murphy EV, et al. The human glioma pathogenesis-related protein is structurally related to plant pathogenesis-related proteins and its gene is expressed specifically in brain tumors. Gene. 1995 Jun 14;159 (1) :131-5.|[3]Wang J, et al. Glioma pathogenesis-related protein 1 performs dual functions in tumor cells. Cancer Gene Ther. 2022 Mar;29 (3-4) :253-263.|[4]Giladi ND, et al. RTVP-1 promotes mesenchymal transformation of glioma via a STAT-3/IL-6-dependent positive feedback loop. Oncotarget. 2015 Sep 8;6 (26) :22680-97.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNBP1L (Formin Binding Protein 1-like, C1orf39, TOCA1) (FITC)
MBS6178746-01 0.1 mL

FNBP1L (Formin Binding Protein 1-like, C1orf39, TOCA1) (FITC)

Sign In for Pricing
View Details
FNBP1L (Formin Binding Protein 1-like, C1orf39, TOCA1) (FITC)
MBS6178746-02 5x 0.1 mL

FNBP1L (Formin Binding Protein 1-like, C1orf39, TOCA1) (FITC)

Sign In for Pricing
View Details
Goat gonadotropin-releasing hormone (GnRH) ELISA Kit
CK-bio-17449-01 48 Tests

Goat gonadotropin-releasing hormone (GnRH) ELISA Kit

Sign In for Pricing
View Details
Goat gonadotropin-releasing hormone (GnRH) ELISA Kit
CK-bio-17449-02 96 Tests

Goat gonadotropin-releasing hormone (GnRH) ELISA Kit

Sign In for Pricing
View Details
Goat gonadotropin-releasing hormone (GnRH) ELISA Kit
CK-bio-17449-03 5x 96 Tests

Goat gonadotropin-releasing hormone (GnRH) ELISA Kit

Sign In for Pricing
View Details
Goat gonadotropin-releasing hormone (GnRH) ELISA Kit
CK-bio-17449-04 10x 96 Tests

Goat gonadotropin-releasing hormone (GnRH) ELISA Kit

Sign In for Pricing
View Details