Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galanin peptides (GAL), partial

Product Specifications

Abbreviation

Recombinant Human GAL protein, partial

Gene Name

GAL

UniProt

P22466

Expression Region

44-123aa

Organism

Homo sapiens (Human)

Target Sequence

GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1, GALR2, and GALR3. This small neuropeptide may regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract, growth hormone and insulin release and adrenal secretion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.4 kDa

References & Citations

"Galanin pathogenic mutations in temporal lobe epilepsy." Guipponi M., Chentouf A., Webling K.E., Freimann K., Crespel A., Nobile C., Lemke J.R., Hansen J., Dorn T., Lesca G., Ryvlin P., Hirsch E., Rudolf G., Rosenberg D.S., Weber Y., Becker F., Helbig I., Muhle H. Antonarakis S.E. Hum. Mol. Genet. 24:3082-3091 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF405S conjugate, 0.1mg/mL
BNC041283-500 1x 500 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details