Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant African swine fever virus Uncharacterized protein K145R

Product Specifications

Product Name Alternative

(pK145R)

Abbreviation

Recombinant African swine fever virus Uncharacterized protein K145R

UniProt

P0CA49

Expression Region

1-145aa

Organism

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Target Sequence

MDHYLKKLEDIYKKLEGHPFLFSPSKTNEKEFITLLNQALASTQLYRSIQQLFLTMYKLDPIGFINYIKTSKQEYLCLLINPKLVTKFLKITSFKIYINFRLKTFYISPNKYNNFYTAPSEEKANHLLKEEKTWAKIVEEGGEES

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTCCGCGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F1 binds preferentially RB1 in a cell-cycle dependent manner. It can mediate both cell proliferation and TP53/p53-dependent apoptosis. Blocks adipocyte differentiation by binding to specific promoters repressing CEBPA binding to its target gene promoters. Directly activates transcription of PEG10. Positively regulates transcription of RRP1B.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.3 kDa

References & Citations

"EAPP, a novel E2F binding protein that modulates E2F-dependent transcription." Novy M., Pohn R., Andorfer P., Novy-Weiland T., Galos B., Schwarzmayr L., Rotheneder H. Mol. Biol. Cell 16:2181-2190 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Influenza A virus Nucleoprotein (NP)
MBS1032586-01 0.02 mg (E-Coli)

Recombinant Influenza A virus Nucleoprotein (NP)

Ask
View Details
Recombinant Influenza A virus Nucleoprotein (NP)
MBS1032586-02 0.02 mg (Yeast)

Recombinant Influenza A virus Nucleoprotein (NP)

Ask
View Details
Recombinant Influenza A virus Nucleoprotein (NP)
MBS1032586-03 0.1 mg (E-Coli)

Recombinant Influenza A virus Nucleoprotein (NP)

Ask
View Details
Recombinant Influenza A virus Nucleoprotein (NP)
MBS1032586-04 0.1 mg (Yeast)

Recombinant Influenza A virus Nucleoprotein (NP)

Ask
View Details
Recombinant Influenza A virus Nucleoprotein (NP)
MBS1032586-05 0.02 mg (Baculovirus)

Recombinant Influenza A virus Nucleoprotein (NP)

Ask
View Details
Recombinant Influenza A virus Nucleoprotein (NP)
MBS1032586-06 0.02 mg (Mammalian-Cell)

Recombinant Influenza A virus Nucleoprotein (NP)

Ask
View Details