Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Mouse (His)

The S100A4 protein, a calcium-binding protein, regulates cellular processes including motility, angiogenesis, differentiation, apoptosis, and autophagy.It interacts with MYH9 to enhance cell motility and chemotaxis.It modulates TP53 to reduce protein levels and stimulates cytokine production.S100A4 forms homodimers and interacts with PPFIBP1, ANXA2, TP53, CCR5, CXCR3, and FCGR3A, inhibiting FCGR3A phosphorylation.S100A4 Protein, Mouse (His) is the recombinant mouse-derived S100A4 protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-mouse-his.html

Purity

98.0

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

20198 (Gene_ID) P07091 (M1-K101) (Accession)

Molecular Weight

Approximately 13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCP1 beta (CCT2) (NM_006431) Human Recombinant Protein
TP313873L 1 mg

TCP1 beta (CCT2) (NM_006431) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Salivary gland
CS706076 5x 5 µm

Tissue FFPE Sections, Salivary gland

Sign In for Pricing
View Details
KRTAP10-12 Human qPCR Primer Pair (NM_198699)
HP219435 200 Reactions

KRTAP10-12 Human qPCR Primer Pair (NM_198699)

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI1B10]
CF812557 100 µg

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI1B10]

Sign In for Pricing
View Details
Umckalin
TRC-U700950-1MG 1 mg

Umckalin

Sign In for Pricing
View Details
Asimilobine Hydrochloride
TRC-A727450-2.5MG 2.5 mg

Asimilobine Hydrochloride

Sign In for Pricing
View Details