Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A4, Mouse (His)

The S100A4 protein, a calcium-binding protein, regulates cellular processes including motility, angiogenesis, differentiation, apoptosis, and autophagy.It interacts with MYH9 to enhance cell motility and chemotaxis.It modulates TP53 to reduce protein levels and stimulates cytokine production.S100A4 forms homodimers and interacts with PPFIBP1, ANXA2, TP53, CCR5, CXCR3, and FCGR3A, inhibiting FCGR3A phosphorylation.S100A4 Protein, Mouse (His) is the recombinant mouse-derived S100A4 protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a4-protein-mouse-his.html

Purity

98.0

Smiles

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Formula

20198 (Gene_ID) P07091 (M1-K101) (Accession)

Molecular Weight

Approximately 13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DECR1 Mouse Monoclonal Antibody [Clone ID: OTI7B11]
CF808951 100 µg

DECR1 Mouse Monoclonal Antibody [Clone ID: OTI7B11]

Sign In for Pricing
View Details
SRRM1 Rabbit Polyclonal Antibody
TA382015 100 µL

SRRM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chlorpyrifos
TRC-C425300-50MG 50 mg

Chlorpyrifos

Sign In for Pricing
View Details
Hes1 Recombinant Rabbit monoclonal Antibody [SC06-21]
ET1610-97-50UL 50 µL

Hes1 Recombinant Rabbit monoclonal Antibody [SC06-21]

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF647 conjugate, 0.1mg/mL
BNC470201-100 1x 100 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Mouse IgM
AAF-445-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Mouse IgM

Sign In for Pricing
View Details