Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Melanoma-associated antigen B2 (MAGEB2)

Product Specifications

Product Name Alternative

Cancer/testis antigen 3.2 (CT3.2) (DSS-AHC critical interval MAGE superfamily 6) (DAM6) (MAGE XP-2 antigen) (MAGE-B2 antigen)

Abbreviation

Recombinant Human MAGEB2 protein

Gene Name

MAGEB2

UniProt

O15479

Expression Region

1-319aa

Organism

Homo sapiens (Human)

Target Sequence

MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAR1A Rabbit mAb
RDSA67827 100 µL

PRKAR1A Rabbit mAb

Sign In for Pricing
View Details
Non-enzymatic, non-cleavable Mouse tPA
MBS480660-01 0.1 mg

Non-enzymatic, non-cleavable Mouse tPA

Sign In for Pricing
View Details
Non-enzymatic, non-cleavable Mouse tPA
MBS480660-02 5x 0.1 mg

Non-enzymatic, non-cleavable Mouse tPA

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit
MBS450242-01 48 Tests

Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit
MBS450242-02 96 Tests

Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit
MBS450242-03 5x 96 Tests

Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit

Sign In for Pricing
View Details