Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER beta/ESR2, Human (His)

ER beta/ESR2 Protein, a nuclear hormone receptor, binds estrogens akin to ESR1/ER-alpha. It activates estrogen-dependent reporter genes with ERE. However, it lacks ligand binding ability and exhibits minimal ERE binding, resulting in the loss of ligand-dependent transactivation ability. ER beta/ESR2 Protein, Human (His) is the recombinant human-derived ER beta/ESR2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER beta/ESR2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-beta-esr2-protein-human-his.html

Purity

90.65

Smiles

MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

Molecular Formula

2100 (Gene_ID) Q92731-3 (M1-A323) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Myc (Thr58) Colorimetric Cell-Based ELISA Kit (OKAG02004)
OKAG02004 2x 96 Well

Phospho-Myc (Thr58) Colorimetric Cell-Based ELISA Kit (OKAG02004)

Sign In for Pricing
View Details
Purified rat liver Ferritin protein WB +ve protein control
FERT25-C 100 µL

Purified rat liver Ferritin protein WB +ve protein control

Sign In for Pricing
View Details
UBQLN2, NT (Ubiquilin 2, Protein Linking IAP with Cytoskeleton-2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2, DSK2 Homolog, Chap1, N4BP4, PLIC2, HRIHFB2157)
MBS627093-01 0.2 mL

UBQLN2, NT (Ubiquilin 2, Protein Linking IAP with Cytoskeleton-2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2, DSK2 Homolog, Chap1, N4BP4, PLIC2, HRIHFB2157)

Sign In for Pricing
View Details
UBQLN2, NT (Ubiquilin 2, Protein Linking IAP with Cytoskeleton-2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2, DSK2 Homolog, Chap1, N4BP4, PLIC2, HRIHFB2157)
MBS627093-02 5x 0.2 mL

UBQLN2, NT (Ubiquilin 2, Protein Linking IAP with Cytoskeleton-2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2, DSK2 Homolog, Chap1, N4BP4, PLIC2, HRIHFB2157)

Sign In for Pricing
View Details
SNCA Rabbit Polyclonal Antibody
E53P09443 100 µL

SNCA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NRXN1 Antibody
OACA09146-50UL 50 µL

NRXN1 Antibody

Sign In for Pricing
View Details