Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17C, Human (Biotinylated, HEK293, His-Avi)

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections[1]. IL-17C Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human IL-17C protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

IL-17C Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17c-protein-human-biotinylated-hek293-his-avi.html

Smiles

HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Molecular Formula

27189 (Gene_ID) Q9P0M4 (H19-V197) (Accession)

Molecular Weight

Approximately 24-26 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Swedik S, et al. IL-17C in human mucosal immunity: More than just a middle child. Cytokine. 2021 Oct;146:155641.|[2]Lauffer F, et al. IL-17C amplifies epithelial inflammation in human psoriasis and atopic eczema. J Eur Acad Dermatol Venereol. 2020 Apr;34 (4) :800-809.|[3]Johnston A, et al. Keratinocyte overexpression of IL-17C promotes psoriasiform skin inflammation. J Immunol. 2013 Mar 1;190 (5) :2252-62.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxiracetam
O040-100MG 100 mg

Oxiracetam

Sign In for Pricing
View Details
LYPLA2 Overexpression Lysate (Native) - (Dry Ice)
NBL1-12761 0.1 mg

LYPLA2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Rabbit Polyclonal EPS15R Antibody
NBP1-84828 0.1 mL

Rabbit Polyclonal EPS15R Antibody

Sign In for Pricing
View Details
TDRD5 (NM_001199092) Human Tagged ORF Clone
RG231304 10 µg

TDRD5 (NM_001199092) Human Tagged ORF Clone

Sign In for Pricing
View Details
FluorViolet 610 Anti-Mouse CD3 Antibody [17A2]
MBS2579400-01 50 Tests

FluorViolet 610 Anti-Mouse CD3 Antibody [17A2]

Sign In for Pricing
View Details
FluorViolet 610 Anti-Mouse CD3 Antibody [17A2]
MBS2579400-02 100 Tests

FluorViolet 610 Anti-Mouse CD3 Antibody [17A2]

Sign In for Pricing
View Details