Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NucA, S. marcescens

The NucA protein plays a central role in cellular processes because it catalyzes the hydrolysis of DNA and RNA (both double- and single-stranded) at the 3' position of the phosphodiester bond to generate 5'-phosphorylated single- and double-stranded , tri- and tetra-nucleotides. This multifunctional enzymatic activity emphasizes the importance of NucA in nucleic acid metabolism, as observed in various studies. NucA Protein, S. marcescens is the recombinant NucA protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NucA Protein, S. marcescens, Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nuca-protein-s-marcescens.html

Purity

98.0

Smiles

MRFNNKMLALAALLFAAQASADTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN

Molecular Formula

87005285 (Gene_ID) P13717 (M1-N266) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BrdU (Bromodeoxyuridine) (BRD.3), 0.2mg/mL
BNUB0885-100 1x 100 µL

BrdU (Bromodeoxyuridine) (BRD.3), 0.2mg/mL

Sign In for Pricing
View Details
N-(2-Hydroxyethyl)-P,P-bisaziridinyl Thiophosphamide
TRC-H942495-50MG 50 mg

N-(2-Hydroxyethyl)-P,P-bisaziridinyl Thiophosphamide

Sign In for Pricing
View Details
COPS8 (N-term) Rabbit Polyclonal Antibody
AP51025PU-N 400 µL

COPS8 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), 1mg/mL
BNUM2561-50 1x 50 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), 1mg/mL

Sign In for Pricing
View Details
THSD7B Human Gene Knockout Kit (CRISPR)
KN417143 1 Kit

THSD7B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, left
CS715697 5x 5 µm

Tissue FFPE Sections, Breast, left

Sign In for Pricing
View Details