Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NucA, S. marcescens

The NucA protein plays a central role in cellular processes because it catalyzes the hydrolysis of DNA and RNA (both double- and single-stranded) at the 3' position of the phosphodiester bond to generate 5'-phosphorylated single- and double-stranded , tri- and tetra-nucleotides. This multifunctional enzymatic activity emphasizes the importance of NucA in nucleic acid metabolism, as observed in various studies. NucA Protein, S. marcescens is the recombinant NucA protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NucA Protein, S. marcescens, Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nuca-protein-s-marcescens.html

Purity

98.0

Smiles

MRFNNKMLALAALLFAAQASADTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN

Molecular Formula

87005285 (Gene_ID) P13717 (M1-N266) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PASK activation kit by CRISPRa
GA108100 1 Kit

Human PASK activation kit by CRISPRa

Sign In for Pricing
View Details
Purified Anti-Human TRAV5 Antibody[MH3-2]
AN003690P-01 25 µg

Purified Anti-Human TRAV5 Antibody[MH3-2]

Sign In for Pricing
View Details
Purified Anti-Human TRAV5 Antibody[MH3-2]
AN003690P-02 100 µg

Purified Anti-Human TRAV5 Antibody[MH3-2]

Sign In for Pricing
View Details
Human H2BC12 activation kit by CRISPRa
GA113836 1 Kit

Human H2BC12 activation kit by CRISPRa

Sign In for Pricing
View Details
BIN1 Human Gene Knockout Kit (CRISPR)
KN402423 1 Kit

BIN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GAGE2D Human Gene Knockout Kit (CRISPR)
KN421614 1 Kit

GAGE2D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details