Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Human (CHO, His)

IL-27 (Interleukin-27) is a heterodimeric cytokine of the IL-12 family, composed of two subunits, EBI3 (Epstein-Barr-virus-induced molecule 3) and p28[1]. IL-27 enhances the development, proliferation, and cytotoxic activity of CD8+ T cells, thereby indirectly promoting anti-tumor immunity[ 2]. IL-27 Protein, Human (CHO, His) is a recombinant protein with a His label that consists of two subunits, EBI3 (IL27B) (229 amino acids (M1-K229) ) and IL27A (214 amino acids (F29-P243) ), is produced by CHO cells.

Product Specifications

Product Name Alternative

IL-27 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-human-cho-his.html

Purity

96.60

Smiles

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK&:FPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP

Molecular Formula

10148& 246778 (Gene_ID) Q14213/NP_005746.2 (R21-K229) &Q8NEV9/NP_663634.2 (F29-P243) (Accession)

Molecular Weight

Approximately 56-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1][1]Liu S, et al. Soluble interleukin-27 receptor alpha is a valuable prognostic biomarker for acute graft-versus-host disease after allogeneic haematopoietic stem cell transplantation. Sci Rep. 2018 Jul 9;8 (1) :10328.|[2][2]Kourko O, et al. IL-27, IL-30, and IL-35: A Cytokine Triumvirate in Cancer. Front Oncol. 2019 Oct 1;9:969.|[3]Fabbi M, et al. Dual Roles of IL-27 in Cancer Biology and Immunotherapy. Mediators Inflamm. 2017;2017:3958069.|[4]Pflanz S, et al. IL-27, a heterodimeric cytokine composed of EBI3 and p28 protein, induces proliferation of naive CD4+ T cells. Immunity. 2002 Jun;16 (6) :779-90.|[5]Petes C, et al. IL-27 amplifies cytokine responses to Gram-negative bacterial products and Salmonella typhimurium infection. Sci Rep. 2018 Sep 12;8 (1) :13704.|[6]Xu F, et al. IL-27 regulates the adherence, proliferation, and migration of MSCs and enhances their regulatory effects on Th1 and Th2 subset generations. Immunol Res. 2017 Aug;65 (4) :903-912.|[7][7]Seita J, et al. Interleukin-27 directly induces differentiation in hematopoietic stem cells. Blood. 2008 Feb 15;111 (4) :1903-12.|[8]Hanson ML, et al. Oral delivery of IL-27 recombinant bacteria attenuates immune colitis in mice. Gastroenterology. 2014 Jan;146 (1) :210-221.e13.|[9]Qi J, et al. IL-27 Regulated CD4+IL-10+ T Cells in Experimental Sjögren Syndrome. Front Immunol. 2020 Aug 11;11:1699.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin (Muscle Cell Marker) (DES/1711), 0.2mg/mL
BNUB1711-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/1711), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant rat GSTp1 protein (His tag)
PDER100174-01 20 µg

Recombinant rat GSTp1 protein (His tag)

Sign In for Pricing
View Details
Recombinant rat GSTp1 protein (His tag)
PDER100174-02 100 µg

Recombinant rat GSTp1 protein (His tag)

Sign In for Pricing
View Details
Recombinant rat GSTp1 protein (His tag)
PDER100174-03 500 µg

Recombinant rat GSTp1 protein (His tag)

Sign In for Pricing
View Details
Recombinant rat GSTp1 protein (His tag)
PDER100174-04 1 mg

Recombinant rat GSTp1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse NGAL/LCN2 Protein (His Tag)
PDEM100225-01 20 µg

Recombinant Mouse NGAL/LCN2 Protein (His Tag)

Sign In for Pricing
View Details