IL-27, Human (CHO, His)

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK&:FPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP

[1][1]Liu S, et al. Soluble interleukin-27 receptor alpha is a valuable prognostic biomarker for acute graft-versus-host disease after allogeneic haematopoietic stem cell transplantation. Sci Rep. 2018 Jul 9;8 (1) :10328.|[2][2]Kourko O, et al. IL-27, IL-30, and IL-35: A Cytokine Triumvirate in Cancer. Front Oncol. 2019 Oct 1;9:969.|[3]Fabbi M, et al. Dual Roles of IL-27 in Cancer Biology and Immunotherapy. Mediators Inflamm. 2017;2017:3958069.|[4]Pflanz S, et al. IL-27, a heterodimeric cytokine composed of EBI3 and p28 protein, induces proliferation of naive CD4+ T cells. Immunity. 2002 Jun;16 (6) :779-90.|[5]Petes C, et al. IL-27 amplifies cytokine responses to Gram-negative bacterial products and Salmonella typhimurium infection. Sci Rep. 2018 Sep 12;8 (1) :13704.|[6]Xu F, et al. IL-27 regulates the adherence, proliferation, and migration of MSCs and enhances their regulatory effects on Th1 and Th2 subset generations. Immunol Res. 2017 Aug;65 (4) :903-912.|[7][7]Seita J, et al. Interleukin-27 directly induces differentiation in hematopoietic stem cells. Blood. 2008 Feb 15;111 (4) :1903-12.|[8]Hanson ML, et al. Oral delivery of IL-27 recombinant bacteria attenuates immune colitis in mice. Gastroenterology. 2014 Jan;146 (1) :210-221.e13.|[9]Qi J, et al. IL-27 Regulated CD4+IL-10+ T Cells in Experimental Sjögren Syndrome. Front Immunol. 2020 Aug 11;11:1699.