Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVRL1/ALK1, Mouse (HEK293, Fc)

ALK-1, also known as ACVRL1, is a type I receptor for TGF-β superfamily with 2 ligands, BMP9 and BMP10. ALK-1 is predominantly expressed in endothelial cells and plays a critical role in regulating developmental and pathological angiogenesis[1][2]. ACVRL1/ALK1 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 97 amino acids (D23-P119) .

Product Specifications

Product Name Alternative

ACVRL1/ALK1 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvrl1-alk1-protein-mouse-hek293-fc.html

Purity

96.30

Smiles

DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLP

Molecular Formula

11482 (Gene_ID) Q61288 (D23-P119) (Accession)

Molecular Weight

55-60 kDa

References & Citations

[1]Kevin J Morine, et al. Reduced Activin Receptor-Like Kinase 1 Activity Promotes Cardiac Fibrosis in Heart Failure. Cardiovasc Pathol. Nov-Dec 2017;31:26-33.|[2]S P Oh, et al. Activin receptor-like kinase 1 modulates transforming growth factor-beta 1 signaling in the regulation of angiogenesis. Proc Natl Acad Sci U S A. 2000 Mar 14;97 (6) :2626-31.|[3]Dianyuan Zhao, et al. ALK1 signaling is required for the homeostasis of Kupffer cells and prevention of bacterial infection. J Clin Invest. 2022 Feb 1;132 (3) :e150489.|[4]Dianne Mitchell, et al. ALK1-Fc inhibits multiple mediators of angiogenesis and suppresses tumor growth. Mol Cancer Ther. 2010 Feb;9 (2) :379-88.|[5]Dongxing Zhu, et al. BMP-9 regulates the osteoblastic differentiation and calcification of vascular smooth muscle cells through an ALK1 mediated pathway. J Cell Mol Med. 2015 Jan;19 (1) :165-74.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cep164 Mouse Gene Knockout Kit (CRISPR)
KN503152 1 Kit

Cep164 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GPRC6A activation kit by CRISPRa
GA116671 1 Kit

Human GPRC6A activation kit by CRISPRa

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF568 conjugate, 0.1mg/mL
BNC682040-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Phosphonobenzoic Acid
TRC-P353805-25MG 25 mg

3-Phosphonobenzoic Acid

Sign In for Pricing
View Details
NCALD (NM_001040624) Human Over-expression Lysate
LC421783 20 µg

NCALD (NM_001040624) Human Over-expression Lysate

Sign In for Pricing
View Details
PRAMEF16 Human Gene Knockout Kit (CRISPR)
KN424687 1 Kit

PRAMEF16 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details