SAA2, Human (His)
Product Specifications
UNSPSC Description
SAA2 Protein, Human (His) is the recombinant human-derived SAA2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SAA2 Protein, Human (His) is 104 a.a., with molecular weight of ~14.0 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/saa2-protein-human-his.html
Purity
97.00
Smiles
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Molecular Weight
Approximately 14.0 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MPX4503K Each
Magic™ Membrane Protein Human SPN (Sialophorin) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (20-253aa)
Sign In for Pricing
View Details 
GTR15078197 1 Vial
Lentiviral human GLA shRNA (UAS) - Lentiviral human GLA shRNA (UAS) (25)
Sign In for Pricing
View Details 
ARP52356_P050-FITC 100 µL
CENTG1 Antibody - middle region : FITC (ARP52356_P050-FITC)
Sign In for Pricing
View Details 
MBS1271597-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
WDR63 cDNA Clone
Sign In for Pricing
View Details