Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA2, Human (His)

Product Specifications

UNSPSC Description

SAA2 Protein, Human (His) is the recombinant human-derived SAA2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SAA2 Protein, Human (His) is 104 a.a., with molecular weight of ~14.0 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa2-protein-human-his.html

Purity

97.00

Smiles

RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK1349572 sodiuM salt
B5856-5 5 mg

GSK1349572 sodiuM salt

Sign In for Pricing
View Details
NFATC1 Antibody
A46843-50UG 50 µg

NFATC1 Antibody

Sign In for Pricing
View Details
SUMO-2 CRISPR Activation Plasmid (h2)
sc-401111-ACT-2 20 µg

SUMO-2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
SLC15A4 Antibody
DF15674-01 100 µL

SLC15A4 Antibody

Sign In for Pricing
View Details
SLC15A4 Antibody
DF15674-02 200 µL

SLC15A4 Antibody

Sign In for Pricing
View Details
Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: LBI6E7]
AMM18743V 100 µL

Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: LBI6E7]

Sign In for Pricing
View Details