Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA2, Human (His)

Product Specifications

UNSPSC Description

SAA2 Protein, Human (His) is the recombinant human-derived SAA2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SAA2 Protein, Human (His) is 104 a.a., with molecular weight of ~14.0 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa2-protein-human-his.html

Purity

97.00

Smiles

RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASMT siRNA (Human)
orb1867943-01 15 nmol

ASMT siRNA (Human)

Sign In for Pricing
View Details
ASMT siRNA (Human)
orb1867943-02 30 nmol

ASMT siRNA (Human)

Sign In for Pricing
View Details
SUCO Double Nickase Plasmid (h)
sc-412202-NIC 20 µg

SUCO Double Nickase Plasmid (h)

Sign In for Pricing
View Details
PKD1P1 siRNA Oligos set (Human)
36865171 3x 5 nmol

PKD1P1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
SYT1 Antibody
OAAF00653-100UG 100 µg

SYT1 Antibody

Sign In for Pricing
View Details
γ Enolase (NSE-P1) Alexa Fluor® 594
sc-21738 AF594 200 µg/mL

γ Enolase (NSE-P1) Alexa Fluor® 594

Sign In for Pricing
View Details