Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD42c/GP1BB, Rat (HEK293, Fc)

The CD42c protein is a platelet surface membrane protein that actively assembles plugs by binding to von Willebrand factor (vWF) in the subendothelium. The GP-Ib heterodimer is formed from the disulfide-linked GP-Ib β subunit and one GP-Ib α subunit, which constitute this protein complex. CD42c/GP1BB Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD42c protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD42c/GP1BB Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd42c-protein-rat-hek293-fc.html

Purity

90.50

Smiles

PAPCRCSETRVDCGRRGLTWASLPAAFPPDTTELVLTDNNLTALPPGLLDTLPALRRVHLGANPWRCDCRLLPLRAWLAGRPEREFYRDLRCVAPLALRGRLLPYVAEDELRAACAPGLLC

Molecular Formula

116727 (Gene_ID) Q9JJM7 (P27-C147) (Accession)

Molecular Weight

Approximately 45-55 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details