CD42c/GP1BB, Rat (HEK293, Fc)
The CD42c protein is a platelet surface membrane protein that actively assembles plugs by binding to von Willebrand factor (vWF) in the subendothelium. The GP-Ib heterodimer is formed from the disulfide-linked GP-Ib β subunit and one GP-Ib α subunit, which constitute this protein complex. CD42c/GP1BB Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD42c protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD42c/GP1BB Protein, Rat (HEK293, Fc), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd42c-protein-rat-hek293-fc.html
Purity
90.50
Smiles
PAPCRCSETRVDCGRRGLTWASLPAAFPPDTTELVLTDNNLTALPPGLLDTLPALRRVHLGANPWRCDCRLLPLRAWLAGRPEREFYRDLRCVAPLALRGRLLPYVAEDELRAACAPGLLC
Molecular Formula
116727 (Gene_ID) Q9JJM7 (P27-C147) (Accession)
Molecular Weight
Approximately 45-55 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF405S conjugate, 0.1mg/mL
