Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Allograft inflammatory factor 1 (Aif1)

Product Specifications

Product Name Alternative

Ionized calcium-binding adapter molecule 1

Abbreviation

Recombinant Mouse Aif1 protein

Gene Name

Aif1

UniProt

O70200

Expression Region

2-147aa

Organism

Mus musculus (Mouse)

Target Sequence

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.8 kDa

References & Citations

X-ray structures of the microglia/macrophage-specific protein Iba1 from human and mouse demonstrate novel molecular conformation change induced by calcium binding.Yamada M., Ohsawa K., Imai Y., Kohsaka S., Kamitori S.J. Mol. Biol. 364:449-457 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12932830/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ASB6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12516062 1.0 µg DNA

ASB6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
Rabbit anti-Saccharomyces cerevisiae (strain Lalvin EC1118/Prise de mousse)(Baker's yeast) LIP5 Polyclonal Antibody
MBS7179599 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain Lalvin EC1118/Prise de mousse)(Baker's yeast) LIP5 Polyclonal Antibody

Ask
View Details
ZW10 Interactor 1 (ZW10-interacting Protein 1, ZWINT 1, ZWINT1, ZWINT-1, ZW10 Interactor, ZWINT, Human ZW10 Interacting Protein 1, HZwint 1, HZwint-1, KNTC2AP, MGC117174) (APC)
MBS6506676-01 0.2 mL

ZW10 Interactor 1 (ZW10-interacting Protein 1, ZWINT 1, ZWINT1, ZWINT-1, ZW10 Interactor, ZWINT, Human ZW10 Interacting Protein 1, HZwint 1, HZwint-1, KNTC2AP, MGC117174) (APC)

Ask
View Details
ZW10 Interactor 1 (ZW10-interacting Protein 1, ZWINT 1, ZWINT1, ZWINT-1, ZW10 Interactor, ZWINT, Human ZW10 Interacting Protein 1, HZwint 1, HZwint-1, KNTC2AP, MGC117174) (APC)
MBS6506676-02 5x 0.2 mL

ZW10 Interactor 1 (ZW10-interacting Protein 1, ZWINT 1, ZWINT1, ZWINT-1, ZW10 Interactor, ZWINT, Human ZW10 Interacting Protein 1, HZwint 1, HZwint-1, KNTC2AP, MGC117174) (APC)

Ask
View Details
ATG5 (Autophagy Protein 5, APG5-like, Apoptosis-specific Protein, APG5L, ASP) (Biotin)
MBS6121141-01 0.2 mL

ATG5 (Autophagy Protein 5, APG5-like, Apoptosis-specific Protein, APG5L, ASP) (Biotin)

Ask
View Details
ATG5 (Autophagy Protein 5, APG5-like, Apoptosis-specific Protein, APG5L, ASP) (Biotin)
MBS6121141-02 5x 0.2 mL

ATG5 (Autophagy Protein 5, APG5-like, Apoptosis-specific Protein, APG5L, ASP) (Biotin)

Ask
View Details