Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Mouse (CHO, His)

IL-13 Protein, Mouse (CHO, His), an important CHO cell derived cytokine, is a multifunctional cytokine whose principal action is to diminish inflammatory responses.

Product Specifications

Product Name Alternative

IL-13 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-mouse-cho-his.html

Purity

95.00

Smiles

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH

Molecular Formula

16163 (Gene_ID) P20109 (P22-F131) (Accession)

Molecular Weight

Approximately 14-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Ma Y, et al. Novel recombinant interleukin-13 peptide-based vaccine reduces airway allergic inflammatoryresponses in mice. Am J Respir Crit Care Med. 2007 Sep 1;176 (5) :439-45.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rgs5 (NM_009063) Mouse Tagged ORF Clone
MG201631 10 µg

Rgs5 (NM_009063) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DR1 (NM_001938) Human Recombinant Protein
TP305733 20 µg

DR1 (NM_001938) Human Recombinant Protein

Sign In for Pricing
View Details
Benzaldehyde-13C Semicarbazone
TRC-B183932-5MG 5 mg

Benzaldehyde-13C Semicarbazone

Sign In for Pricing
View Details
Ostruthin Imperatorin
TRC-O703908-1MG 1 mg

Ostruthin Imperatorin

Sign In for Pricing
View Details
Metoxadiazone
TRC-M338840-10MG 10 mg

Metoxadiazone

Sign In for Pricing
View Details
COMT Antibody
KC-2779-01 50 μL

COMT Antibody

Sign In for Pricing
View Details