Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAP-2/CXCL7, Human (CHO)

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Human (CHO) is produced in CHO cells, and consists of 70 amino acids (A59-D128) .

Product Specifications

Product Name Alternative

NAP-2/CXCL7 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-human-cho.html

Purity

98.0

Smiles

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Molecular Formula

5473 (Gene_ID) P02775 (A59-D128) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Oda M, et al. Thrombopoietin-induced CXC chemokines, NAP-2 and PF4, suppress polyploidization and proplatelet formation during megakaryocyte maturation. Genes Cells. 2003 Jan;8 (1) :9-15.|[2]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[3]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.|[4]Laurens Kruidenier, et al. Myofibroblast matrix metalloproteinases activate the neutrophil chemoattractant CXCL7 from intestinal epithelial cells. Gastroenterology. 2006 Jan;130 (1) :127-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFF4 Protein Vector (Human) (pPB-His-GST)
PV320339 500 ng

AFF4 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Chlamydia trachomatis, HMW Protein (C. trachomatis) (MaxLight 550) discontinued
C4250-02H-ML550 100 µL

Chlamydia trachomatis, HMW Protein (C. trachomatis) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ITX5061
BA1863-5 5 mg

ITX5061

Sign In for Pricing
View Details
LHON Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV730963 1.0 µg DNA

LHON Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Anti-RIAM/APBB1IP Antibody Picoband®, Dylight594 Conjugate
PA1960-Dylight594 100 µg

Anti-RIAM/APBB1IP Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
OLR1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1482205 3x 1.0 µg

OLR1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details